PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00679
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family G2-like
Protein Properties Length: 347aa    MW: 38828.7 Da    PI: 8.5861
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00679genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.7e-32211266156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rF++a++qLGGs++AtPk+i++lmkv+gLt+++vkSHLQkYRl+
  AA39G00679 211 KQRRCWSPELHRRFLNALQQLGGSQVATPKQIRDLMKVDGLTNDEVKSHLQKYRLH 266
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.869208268IPR017930Myb domain
SuperFamilySSF466893.58E-17209267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28210268IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-27211266IPR006447Myb domain, plants
PfamPF002492.5E-7213264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MFKKGEIDCT MKMQRSLEYI EALEEEQKKI QVFKRELPLC SELISQVIES WRKELSGSAT  60
SEHLHGQSEC SERTMSESGG GGAVFEEFIP MKSTSSSDEN GEPASSDPKN DGAEMESENK  120
IDKKKSDWLR SVQLWNQSPD PQLKEKSTAV EIKTNGGAFH PFQKDKTLAV PKLDSPPQPP  180
TTSSSTPESG ECKKESEHHK QPQTQTQSLR KQRRCWSPEL HRRFLNALQQ LGGSQVATPK  240
QIRDLMKVDG LTNDEVKSHL QKYRLHTRIK TAAATPVREK VEEAQFMMVK WIPATDVTTS  300
NKVYAPVAVQ PPPLSPKRTA ERSSGRGRCN SPANILFHTN TASSPLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010551302.11e-115PREDICTED: probable transcription factor GLK2
TrEMBLQ9FPE81e-112Q9FPE8_ARATH; At1g25550/F2J7_21
STRINGAT1G25550.11e-111(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-114G2-like family protein